PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009764081.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 751aa    MW: 84666.6 Da    PI: 6.5666
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009764081.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS392.83.8e-1203797482374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++ L+ cA+av+++d + a+++L+++++++s+ gd mqRla+y++++L+ar+a+s++++y al + +ts    +++l+a++lf  ++P+ k+s++
  XP_009764081.1 379 RTILTLCAQAVAADDRRTANEFLKQIRQNSSSMGDGMQRLAHYVANGLEARMAGSGTQIYTALISMPTS---AADVLKAYQLFLAACPFRKLSNF 470
                     67899**********************************************************999998...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                       N++I++ +e++++vHiiDf+i++G+QWp+++q L+sRp+gpp+lRiTg++ p++g   +e++eetg+rLa++Ae+++vpfef++ +ak++e++
  XP_009764081.1 471 FSNKTIMNVAERAKTVHIIDFGIMYGFQWPCFIQRLSSRPGGPPKLRITGIDFPNPGfrPAERVEETGKRLANYAESFNVPFEFKA-IAKKWETI 564
                     ********************************************************9*****************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++e+L+++++E+l+Vn+ ++  +llde+v ++s+rd vL+l++ l+P+v++    +  +n++ F +rf eal +ys++fd+lea++pre +er+ 
  XP_009764081.1 565 KVEDLEIRKDEVLVVNCLYRFRNLLDETVVVNSPRDIVLNLIRMLKPDVFIQGIVNGAYNAPFFITRFREALFHYSSVFDMLEANIPREIHERML 659
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +E+ ++gre++nvvace aer+er et+++W+ r  +aGF+++pl+e++ ++ak  ++ +++d + ++ + ++l++gWk+r ++++S W+
  XP_009764081.1 660 IEKIIFGREVMNVVACEAAERIERPETYKQWKVRNIRAGFRQLPLNEEIRSTAKERVKAYHKD-FVIDVDGHWLLQGWKGRIVYALSTWK 748
                     *************************************************************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.348352729IPR005202Transcription factor GRAS
PfamPF035141.3E-117379748IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MVMDKNYKGL YEATSAIQLK DEDLSFFPDL NLINNLRVSD HTLVQRNHVN IPQFQPDVLV  60
PSAVYNTHED YDFSDVVLTY ISQMLMEENI EEKACMFQES AALQAAERSF YEVIGKKYPP  120
SHNQEMPNLG QIDGRYPVDS SSSNYVDSSS SNYYSCISDV SDGLLCPNWN PDIGGDSDSS  180
HAQHFPVDGA VASTSQSSHS SPSSSGTVTD AHLDSPVSSI QIPDIFSDSE SIMQFKKGVE  240
EASKFLPTGN SLLLDVRFNV VGKEDNEYGK NAVVKVENWG KHQSPEGSRG KKNVHHDDVD  300
AMEERSNKQS AVFSESTVRS EMFDRVLLCS GGKNESALRE SWQTVSSKNT PEDGLPKGSN  360
GRKSRGKRQG SKRDTVDLRT ILTLCAQAVA ADDRRTANEF LKQIRQNSSS MGDGMQRLAH  420
YVANGLEARM AGSGTQIYTA LISMPTSAAD VLKAYQLFLA ACPFRKLSNF FSNKTIMNVA  480
ERAKTVHIID FGIMYGFQWP CFIQRLSSRP GGPPKLRITG IDFPNPGFRP AERVEETGKR  540
LANYAESFNV PFEFKAIAKK WETIKVEDLE IRKDEVLVVN CLYRFRNLLD ETVVVNSPRD  600
IVLNLIRMLK PDVFIQGIVN GAYNAPFFIT RFREALFHYS SVFDMLEANI PREIHERMLI  660
EKIIFGREVM NVVACEAAER IERPETYKQW KVRNIRAGFR QLPLNEEIRS TAKERVKAYH  720
KDFVIDVDGH WLLQGWKGRI VYALSTWKAA Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-473787485375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009764081.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009764082.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM1A7D30.0M1A7D3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000162580.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14